>1n32_F mol:protein length:101  30S RIBOSOMAL PROTEIN S6
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGY
FLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA