>1n32_G mol:protein length:155  30S RIBOSOMAL PROTEIN S7
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLK
VFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVR
IAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW