>1n32_R mol:protein length:88  30S RIBOSOMAL PROTEIN S18
MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLS
GKEQRILAKTIKRARILGLLPFTEKLVRK