>1n34_H mol:protein length:138  30S RIBOSOMAL PROTEIN S8
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYL
RVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGV
LTDREARKLGVGGELICEVW