>1n34_S mol:protein length:92  30S RIBOSOMAL PROTEIN S19
PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPV
YITENMVGHKLGEFAPTRTYRGHGKEAKATKKK