>1n6u_A mol:protein length:212  Interferon-alpha/beta receptor beta chain
SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCA
NTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFT
NHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNT
NYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS