>1n89_A mol:protein length:67  lipid transfer protein
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTS
CGLAVPHC
>1n89_A mol:protein length:67  lipid transfer protein
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTS
CGLAVPHC