>1n8r_L mol:protein length:132  50S ribosomal protein L14P
MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTK
GTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVA
QRFGSVASAATMIV