>1n8r_M mol:protein length:164  50S ribosomal protein L15P
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQE
EAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHEL
TLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE