>1n8r_N mol:protein length:194  50S ribosomal protein L15E
ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQG
IIVVRVAIRKGSSRRTRFNKGRRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSY
SVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTFRGLTSAGRRCRGLRGQG
KGSEKVRPSLRVNGAKA