>1n8r_Q mol:protein length:148  50S ribosomal protein L19E
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSR
GRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQ
YRDLYDKAGGGEFDSVADLERYIDANHGDA