>1n8r_R mol:protein length:95  50S ribosomal protein L21e
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQ
TGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE