>1n8r_X mol:protein length:154  50S ribosomal protein L30P
MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQ
ETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRL
HPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR