>1n99_B mol:protein length:166  Syntenin 1
GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENC
AGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDS
SAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
>1n99_B mol:protein length:166  Syntenin 1
GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENC
AGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDS
SAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
>1n99_A mol:protein length:166  Syntenin 1
GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENC
AGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDS
SAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF