>1nb9_A mol:protein length:147  hypothetical protein FLJ11149
RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHK
MVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAI
QGDIEEAKKRLELPEYLKIKEDNFFQVSK