>1nfd_B mol:protein length:239  N15 ALPHA-BETA T-CELL RECEPTOR
DSGVVQSPRHIIKEKGGRSVLTCIPISGHSNVVWYQQTLGKELKFLIQHYEKVERDKGF
LPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASSLRWGDEQYFGPGTRLTVLEDLRNV
TPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKE
SNYSYSLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGR
ADC