>1nfd_F mol:protein length:222  H57 FAB
EVYLVESGGDLVQPGSSLKVSCAASGFTFSDFWMYWVRQAPGKGLEWVGRIKNIPNNYA
TEYADSVRGRFTISRDDSRNSIYLQMNRLRVDDTAIYYCTRAGRFDHFDYWGQGTMVTV
SSATTTAPSVYPLAPACDSTTSTTDTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPS
VLHSGLYSLSSSVTVPSSTWPKQPITCNVAHPASSTKVDKKIEPR