>1nh2_B mol:protein length:53  Transcription initiation factor IIA large chain
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTF
>1nh2_A mol:protein length:180  Transcription initiation factor TFIID
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASG
KMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFS
HGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEF
RKM
>1nh2_D mol:protein length:121  Transcription initiation factor IIA small chain
AVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKL
TVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSK
KSE
>1nh2_F mol:na length:16  5'-D(*GP*TP*TP*TP*TP*AP*TP*AP*TP*AP*CP*AP*TP*AP*CP*A)-3'
GTTTTATATACATACA
>1nh2_E mol:na length:16  5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C)-3'
TGTAUGTATAUAAAAC
>1nh2_F mol:na length:16  5'-D(*GP*TP*TP*TP*TP*AP*TP*AP*TP*AP*CP*AP*TP*AP*CP*A)-3'
GTTTTATATACATACA
>1nh2_C mol:protein length:79  Transcription initiation factor IIA large chain
GSSALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGV
VTINRNDYTFQKAQVEAEWV