>1nji_4 mol:protein length:92  50S ribosomal protein L44E
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGD
KPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE