>1nji_J mol:protein length:167  50S ribosomal protein L10e
KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHN
ALEAARVAANRYVQNSGAAANYKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKP
VGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINIDSSPAGNA