>1nji_T mol:protein length:84  50S ribosomal protein L23P
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMD
GEKKAVVRLSEDDDAQEVASRIGVF