>1nji_V mol:protein length:66  50S ribosomal protein L24E
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEA
GEAEDEA