>1nji_Y mol:protein length:91  50S ribosomal protein L31E
SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAW
ARGRANTPSKIRVRAARFEEEGEAIVEAETAE