>1nkn_D mol:protein length:89  S2N51-GCN4
GSHMPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMK
QLEDKVEELLSKNYHLENEVARLKKLVGER