>1noy_S mol:na length:3  DNA (5'-D(*TP*TP*T)-3')
TTT
>1noy_A mol:protein length:388  PROTEIN (DNA POLYMERASE (E.C.2.7.7.7))
MDEFYISIETVGNNIVERYIDENGKERTREVEYLPTMFRHCKEESKYKDIYGKNCAPQK
FPSMKDARDWMKRMEDIGLEALGMNDFKLAYISDTYGSEIVYDRKFVRVANCDIEVTGD
KFPDPMKAEYEIDAITHYDSIDDRFYVFDLLNSMYGSVSKWDAKLAAKLDCEGGDEVPQ
EILDRVIYMPFDNERDMLMEYINLWEQKRPAIFTGWNIEGFDVPYIMNRVKMILGERSM
KRFSPIGRVKSKLLQNMYGSKEIYSIDGVSILDYLDLYKKFAFTNLPSFSLESVAQHET
KKGKLPYDGPINKLRETNHQRYISYNIIDVESVQAIDKIRGFIDLVLSMSYYAKMPFSG
VMSPIKTWDAIIFNSLKGEHKVIPQQGSHVKQSF
>1noy_S mol:na length:3  DNA (5'-D(*TP*TP*T)-3')
TTT
>1noy_B mol:protein length:388  PROTEIN (DNA POLYMERASE (E.C.2.7.7.7))
MDEFYISIETVGNNIVERYIDENGKERTREVEYLPTMFRHCKEESKYKDIYGKNCAPQK
FPSMKDARDWMKRMEDIGLEALGMNDFKLAYISDTYGSEIVYDRKFVRVANCDIEVTGD
KFPDPMKAEYEIDAITHYDSIDDRFYVFDLLNSMYGSVSKWDAKLAAKLDCEGGDEVPQ
EILDRVIYMPFDNERDMLMEYINLWEQKRPAIFTGWNIEGFDVPYIMNRVKMILGERSM
KRFSPIGRVKSKLLQNMYGSKEIYSIDGVSILDYLDLYKKFAFTNLPSFSLESVAQHET
KKGKLPYDGPINKLRETNHQRYISYNIIDVESVQAIDKIRGFIDLVLSMSYYAKMPFSG
VMSPIKTWDAIIFNSLKGEHKVIPQQGSHVKQSF