>1nsh_A mol:protein length:101  Calgizzarin
SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRM
MKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF