>1o0w_B mol:protein length:252  Ribonuclease III
MGSDKIHHHHHHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDV
ESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKF
LFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEM
LFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAE
KEAARIAYEKLLKERS
>1o0w_B mol:protein length:252  Ribonuclease III
MGSDKIHHHHHHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDV
ESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKF
LFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEM
LFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAE
KEAARIAYEKLLKERS
>1o0w_A mol:protein length:252  Ribonuclease III
MGSDKIHHHHHHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDV
ESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKF
LFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEM
LFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAE
KEAARIAYEKLLKERS