>1o19_T mol:protein length:145  SKELETAL MUSCLE MYOSIN II REGULATORY LIGHT CHAIN
FDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINF
TVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTGGGRFTPEEIKNM
WAAFPPDVAGNVDYKNICYVITHGEDA