>1o19_U mol:protein length:147  SKELETAL MUSCLE MYOSIN II ESSENTIAL LIGHT CHAIN
SKAAADDFKEAFLLFDRTGDAKITASQVGDIARALGQNPTNAEINKILGNPSKEEMNAA
AITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTE
EEVEELMKGQEDSNGCINYEAFVKHIMSV