>1o1l_A mol:protein length:283  Hemoglobin Alpha chain
MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQG
KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFT
PAVHASLDKFLASVSTVLTSKYRGVLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLS
FPTTKTYFPHFDLSHGSAQVKGQGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVD
PVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR