>1o1l_B mol:protein length:146  Hemoglobin Beta chain
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF
GKEFTPPVQAAYQKVVAGVANALAHKYH