>1o4x_D mol:na length:19  5'-D(*CP*AP*TP*TP*AP*GP*CP*AP*TP*GP*AP*CP*AP*AP*AP*GP*AP*CP*A)-3'
CATTAGCATGACAAAGACA
>1o4x_B mol:protein length:88  Transcription factor SOX-2
GSHMPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFID
EAKRLRALHMKEHPDYKYRPRRKTKTLMK
>1o4x_D mol:na length:19  5'-D(*CP*AP*TP*TP*AP*GP*CP*AP*TP*GP*AP*CP*AP*AP*AP*GP*AP*CP*A)-3'
CATTAGCATGACAAAGACA
>1o4x_A mol:protein length:167  transcription factor Oct-1
GSHMEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNL
SFKNMAKLKPLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLSERRKKRTSIETNIRVA
LEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSS
>1o4x_C mol:na length:19  5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*G)-3'
TGTCTTTGTCATGCTAATG