>1o6l_A mol:protein length:337  RAC-BETA SERINE/THREONINE PROTEIN KINASE
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVL
QNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSAL
EYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVL
EDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLL
AGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD
DEFTAQSITITPPDRYDSLGLLELDQREEQEMFEDFDYIADW
>1o6l_C mol:protein length:10  GLYCOGEN SYNTHASE KINASE-3 BETA
GRPRTTSFAE
>1o6l_C mol:protein length:10  GLYCOGEN SYNTHASE KINASE-3 BETA
GRPRTTSFAE