>1o9u_B mol:protein length:18  AXIN PEPTIDE
VEPQKFAEELIHRLEAVQ
>1o9u_A mol:protein length:350  GLYCOGEN SYNTHASE KINASE-3 BETA
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAF
KNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPATVYRVARHYSRAKQT
LPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGE
PNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEII
KVLGTPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARL
TPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI