>1ofd_A mol:protein length:1520  FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE 2
CGVGFIANLRGKPDHTLVEQALKALGCMEHRGGCSADNDSGDGAGVMTAIPRELLAQWF
NTRNLPMPDGDRLGVGMVFLPQEPSAREVARAYVEEVVRLEKLTVLGWREVPVNSDVLG
IQAKNNQPHIEQILVTCPEGCAGDELDRRLYIARSIIGKKLAEDFYVCSFSCRTIVYKG
MVRSIILGEFYLDLKNPGYTSNFAVYHRRFSTNTMPKWPLAQPMRLLGHNGEINTLLGN
INWMAAREKELEVSGWTKAELEALTPIVNQANSDSYNLDSALELLVRTGRSPLEAAMIL
VPEAYKNQPALKDYPEISDFHDYYSGLQEPWDGPALLVFSDGKIVGAGLDRNGLRPARY
CITKDDYIVLGSEAGVVDLPEVDIVEKGRLAPGQMIAVDLAEQKILKNYQIKQQAAQKY
PYGEWIKIQRQTVASDSFAEKTLFNDAQTVLQQQAAFGYTAEDVEMVVVPMASQGKEPT
FCMGDDTPLAVLSHKPRLLYDYFKQRFAQVTNPPIDPLRENLVMSLAMFLGKRGNLLEP
KAESARTIKLRSPLVNEVELQAIKTGQLQVAEVSTLYDLDGVNSLEDALTNLVKTAIAT
VQAGAEILVLTDRPNGAILTENQSFIPPLLAVGAVHHHLIRAGLRLKASLIVDTAQCWS
THHFACLVGYGASAICPYLALESVRQWWLDEKTQKLMENGRLDRIDLPTALKNYRQSVE
AGLFKILSKMGISLLASYHGAQIFEAIGLGAELVEYAFAGTTSRVGGLTIADVAGEVMV
FHGMAFPEMAKKLENFGFVNYRPGGEYHMNSPEMSKSLHKAVAAYKVGGNGNNGEAYDH
YELYRQYLKDRPVTALRDLLDFNADQPAISLEEVESVESIVKRFCTGGMSLGALSREAH
ETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSPTLPHLHGLQNGDTANSAIKQ
IASGRFGVTPEYLMSGKQLEIKMAQGAKPGEGGQLPGKKVSEYIAMLRRSKPGVTLISP
PPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIGIGTIAAGVAKANADIIQISGHD
GGTGASPLSSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALMG
AEEYGFGSIAMIAEGCIMARVCHTNNCPVGVATQQERLRQRFKGVPGQVVNFFYFIAEE
VRSLLAHLGYRSLDDIIGRTDLLKVRSDVQLSKTQNLTLDCLLNLPDTKQNRQWLNHEP
VHSNGPVLDDDILADPDIQEAINHQTTATKTYRLVNTDRTVGTRLSGAIAKKYGNNGFE
GNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPEDN
VIIGNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEGAGDHCCEYMTGGVIVVLGPV
GRNVGAGMTGGLAYFLDEVGDLPEKINPEIITLQRITASKGEEQLKSLITAHVEHTGSP
KGKAILANWSDYLGKFWQAVPPSEKDSPEANNDVSLTGEKTLTSV