>1ow8_F mol:protein length:13  Paxillin
NLSELDRLLLELN
>1ow8_C mol:protein length:161  Focal adhesion kinase 1
SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVM
TSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
>1ow8_A mol:protein length:161  Focal adhesion kinase 1
SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVM
TSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
>1ow8_D mol:protein length:13  Paxillin
NLSELDRLLLELN
>1ow8_F mol:protein length:13  Paxillin
NLSELDRLLLELN
>1ow8_B mol:protein length:161  Focal adhesion kinase 1
SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVM
TSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH