>1ow8_A mol:protein length:161  Focal adhesion kinase 1
SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVM
TSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH