>1ow8_C mol:protein length:161  Focal adhesion kinase 1
SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVM
TSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH