>1oz7_A mol:protein length:131  echicetin A-chain
MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENI
GKMYKIWTGLSERSKEQHCSSRWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCE
NTFPFMCKYPVPR
>1oz7_B mol:protein length:123  echicetin B-chain
NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPML
KNDLVWIGLTDYWRDCNWEWSDGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFV
CKCPA
>1oz7_B mol:protein length:123  echicetin B-chain
NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPML
KNDLVWIGLTDYWRDCNWEWSDGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFV
CKCPA