>1oz7_A mol:protein length:131  echicetin A-chain
MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENI
GKMYKIWTGLSERSKEQHCSSRWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCE
NTFPFMCKYPVPR