>1oz7_B mol:protein length:123  echicetin B-chain
NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPML
KNDLVWIGLTDYWRDCNWEWSDGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFV
CKCPA