>1ozj_B mol:protein length:144  SMAD 3
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQN
VNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKD
EVCVNPYHYQRVETPVLPPVLVPRHT