>1p4k_C mol:protein length:295  N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase
TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDR
DGRVTLDACIMDENYNIGSVACMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGF
KKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDAQGNLSGACTTSGMAYKM
HGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAV
ERIVKIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
>1p4k_A mol:protein length:295  N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase
TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDR
DGRVTLDACIMDENYNIGSVACMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGF
KKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDAQGNLSGACTTSGMAYKM
HGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAV
ERIVKIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK
>1p4k_C mol:protein length:295  N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase
TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDR
DGRVTLDACIMDENYNIGSVACMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGF
KKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDAQGNLSGACTTSGMAYKM
HGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAV
ERIVKIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK