>1p4v_A mol:protein length:295  N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase precursor
TTNKPIVLSTWNFGLHANVEAWKVLSKGGKALDAVEKGVRLVEDDPTERSVGYGGRPDR
DGRVTLDACIMDENYNIGSVACMEHIKNPISVARAVMEKTPHVMLVGDGALEFALSQGF
KKENLLTAESEKEWKEWLKTSQYKPIVNIENHNTIGMIALDAQGNLSGACTTSGMAYKM
HGRVGDSPIIGAGLFVDNEIGAATATGHGEEVIRTVGTHLVVELMNQGRTPQQACKEAV
ERIVKIVNRRGKNLKDIQVGFIALNKKGEYGAYCIQDGFNFAVHDQKGNRLETPGFALK