>1p84_I mol:protein length:55  Ubiquinol-cytochrome C reductase complex 7.3 kDa protein
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA