>1pd3_A mol:protein length:58  Nonstructural protein NS2
QNRNGKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF