>1pi8_A mol:protein length:36  VPU protein
MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK