>1prx_B mol:protein length:224  HORF6
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAP
EFAKRNVKLIALSIDSVEDHLAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLD
PAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVAT
PVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP