>1pvr_D mol:na length:34  34-MER
ATAACTTCGTATAGCATACATTATACGAAGTTAT
>1pvr_A mol:protein length:349  Recombinase CRE
MHHHHHHSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWA
AWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNA
VSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTL
LRLAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGV
ADDPNNYLFCRVRKNGVAAPSATSQLSNSALGGIFGATHRLIYGAKDDSGQRYLAWSGH
SARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLEDGD
>1pvr_C mol:na length:34  34-MER
ATAACTTCGTATAATGTATGCTATACGAAGTTAT
>1pvr_D mol:na length:34  34-MER
ATAACTTCGTATAGCATACATTATACGAAGTTAT
>1pvr_B mol:protein length:349  Recombinase CRE
MHHHHHHSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWA
AWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNA
VSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTL
LRLAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGV
ADDPNNYLFCRVRKNGVAAPSATSQLSNSALGGIFGATHRLIYGAKDDSGQRYLAWSGH
SARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLEDGD