>1py1_D mol:protein length:158  ADP-ribosylation factor binding protein GGA1
GSEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSP
QEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILE
LLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTF